DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Cdx1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_034010.3 Gene:Cdx1 / 12590 MGIID:88360 Length:268 Species:Mus musculus


Alignment Length:169 Identity:52/169 - (30%)
Similarity:68/169 - (40%) Gaps:31/169 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 PPPVTSAGLSALTGAG-IPRFSIAAAAAGMAQ-YLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLV 432
            |.|..||...|....| .|.||...|..|... .|:||.|||....:.....||           
Mouse    78 PGPTASAASPAPLAFGPPPDFSPVPAPPGPGPGILAQSLGAPGAPSSPGAPRRT----------- 131

  Fly   433 ANPIAWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERA 497
              |..|..|         |.:......:.|...|...|..::..|...|||.|..::|:....::
Mouse   132 --PYEWMRR---------SVAAAGGGGSGKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKS 185

  Fly   498 KLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQ 536
            :||..||::|.|||:||||||.|.||       ..|:||
Mouse   186 ELAANLGLTERQVKIWFQNRRAKERK-------VNKKKQ 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 6/18 (33%)
Homeobox 469..523 CDD:395001 22/53 (42%)
Cdx1NP_034010.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..152 24/95 (25%)
Caudal_act 13..138 CDD:282574 21/72 (29%)
Interaction with DNA. /evidence=ECO:0000250|UniProtKB:P47902 157..178 6/20 (30%)
Homeobox 158..210 CDD:278475 22/51 (43%)
Interaction with 5-mCpG DNA. /evidence=ECO:0000250|UniProtKB:P47902 196..207 8/10 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 209..268 5/16 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.