DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and Nkx3-2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_031550.2 Gene:Nkx3-2 / 12020 MGIID:108015 Length:333 Species:Mus musculus


Alignment Length:390 Identity:95/390 - (24%)
Similarity:134/390 - (34%) Gaps:144/390 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 MLLKAAHGGGLKDSDSPSTTPPPASSRLHSDSSPSP---RYEHNSSPGVDSAKSYALSQRSSGAE 224
            :|.|....|||.   :|...|.|..:.:...::|:.   |....:..|       ||    .|||
Mouse    17 ILNKKEERGGLA---TPEGRPAPGGTEVAVTAAPAVCCWRIFGETEAG-------AL----GGAE 67

  Fly   225 DPCQTSESASPPPQGQNDYSPENLSSQRAKFQHHHGVNPLA-LHNANHAG---------NPGCHN 279
            |....|.:.:....||:..||....|..|..:.:.|....| :..|:..|         .|||. 
Mouse    68 DSLLASPARTRTAVGQSAESPGGWDSDSALSEENEGRRRCADVPGASGTGRARVTLGLDQPGCE- 131

  Fly   280 NNNHMDHKLPLSFLGPPLAALHSMTTEMKGQGVGGSSASANGLSYSHSPNSHLISDRGSGGSSSS 344
                             |.|...:..|...:.....|||.:|   .|||       ||...|.|.
Mouse   132 -----------------LHAAKDLEEEAPVRSDSEMSASVSG---DHSP-------RGEDDSVSP 169

  Fly   345 SSTTTTNTNSQGAPNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAP 409
            .          ||..|                ||....|:|        |:.|.|..:.:.:   
Mouse   170 G----------GARVP----------------GLRGAAGSG--------ASGGQAGGVEEEE--- 197

  Fly   410 LKTHAGHIVDRTHLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFS 474
                                    .|.|.:.|                        ||.:|..||
Mouse   198 ------------------------EPAAPKPR------------------------KKRSRAAFS 214

  Fly   475 GQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRH-AAEM---ATAKRK 535
            ..|:|.||:.|...:||:|||||.||.:|.::|:|||:||||||.|.::|. ||::   |.|.:|
Mouse   215 HAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKK 279

  Fly   536  535
            Mouse   280  279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 47/221 (21%)
Homeobox 469..523 CDD:395001 29/53 (55%)
Nkx3-2NP_031550.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 74..121 10/46 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 137..212 28/169 (17%)
Homeobox 209..262 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.