DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment HGTX and VAX1

DIOPT Version :9

Sequence 1:	NP_001368954.1	Gene:	HGTX / 53446	FlyBaseID:	FBgn0040318	Length:	587	Species:	Drosophila melanogaster
Sequence 2:	NP_001106175.1	Gene:	VAX1 / 11023	HGNCID:	12660	Length:	334	Species:	Homo sapiens

Alignment Length:	124	Identity:	43/124 - (34%)
Similarity:	65/124 - (52%)	Gaps:	24/124 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly   465 KKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEM 529
            :.|.||.:|:.:|::.||..|::.:|:.|.||.:||..|.:||:||||||||||||.:|
Human    99 RPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKK------ 157

  Fly   530 ATAKRKQDDMGGDND--GDCSETMDSDN--ESLDMGE------SPAQNKRCRSNSSGSS 578
                    |.|.|::  ...|||..:.:  ..|:.|.      .||....|.:.:.||:
Human   158 --------DQGKDSELRSVVSETAATCSVLRLLEQGRLLSPPGLPALLPPCATGALGSA 208

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
HGTX	NP_001368954.1	ROM1	179..>388	CDD:227709
HGTX	NP_001368954.1	Homeobox	469..523	CDD:395001	28/53 (53%)
VAX1	NP_001106175.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..41
		COG5576	66..184	CDD:227863	37/98 (38%)
		Homeobox	103..157	CDD:365835	28/53 (53%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	234..263
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	314..334
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0850
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810