DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and ATHB54

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001322131.1 Gene:ATHB54 / 10723019 AraportID:AT1G27045 Length:252 Species:Arabidopsis thaliana


Alignment Length:157 Identity:43/157 - (27%)
Similarity:65/157 - (41%) Gaps:39/157 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 KKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRH---- 525
            ||:...|.    |:..||::||:.|.|....:..||..||:..|||.|||||||.:::.:.    
plant    68 KKRKLTPI----QLRLLEESFEEEKRLEPDRKLWLAEKLGLQPSQVAVWFQNRRARYKTKQLEHD 128

  Fly   526 --AAEMATAKRKQD--------------------------DMGGDNDGDCSETMDSDNESLDMGE 562
              :.:.:.||.|.|                          .....|..|..:.:|...|.|.|.|
plant   129 CDSLKASYAKLKTDWDILFVQNQTLKSKVQFLNRLTSHYFQESVQNFDDTFKQVDLLKEKLKMQE 193

  Fly   563 S-PAQN-KRCRSNSSGSSQQQQDNYRH 587
            : ..|: :|.|....||| .:.||.::
plant   194 NLETQSIERKRLGEEGSS-VKSDNTQY 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 22/53 (42%)
ATHB54NP_001322131.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.