DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and dlx4

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_002935758.3 Gene:dlx4 / 100494171 XenbaseID:XB-GENE-876742 Length:253 Species:Xenopus tropicalis


Alignment Length:236 Identity:61/236 - (25%)
Similarity:88/236 - (37%) Gaps:84/236 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 QSQGAPLKTHAGH-----IVDRTH--LYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHPS-- 459
            |||.:|...| ||     .:...|  |:.||........:.:....|   |.:..|.|.|:.|  
 Frog    28 QSQHSPALAH-GHYPLHGFLPTAHEGLFSPGTPSFGGRTLPYPYASS---SHHHQQQHHHNGSAY 88

  Fly   460 -----------------------------------NDKDGKKKHTRPTFSGQQIFALEKTFEQTK 489
                                               |.|..|.:..|..:|..|:.||.:.|:||:
 Frog    89 LNYQQYTSTIGSSARLHEDQEMEKSTVIENGEIRINGKGKKIRKPRTIYSSLQLQALNQRFQQTQ 153

  Fly   490 YLAGPERAKLAYALGMSESQVKVWFQNRRTKWRK--RHAAEMATAKRKQDDMGGDNDGDCSETMD 552
            |||.||||:||..||::::|||:||||:|:|::|  :|.                     |...|
 Frog   154 YLALPERAELAAQLGLTQTQVKIWFQNKRSKYKKVMKHG---------------------SSVQD 197

  Fly   553 SDNESLDMGESPAQNKRCRSN--------SSGSSQQQQDNY 585
            .|..:.....:|     |..|        |:|.|.....||
 Frog   198 EDQPASSSALTP-----CSPNMPPLWDIPSTGKSAPLSCNY 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 28/53 (53%)
dlx4XP_002935758.3 COG5576 98..239 CDD:227863 44/162 (27%)
Homeobox 133..187 CDD:395001 28/53 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.