DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and nkx6-3

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_002932753.1 Gene:nkx6-3 / 100489301 XenbaseID:XB-GENE-478609 Length:255 Species:Xenopus tropicalis


Alignment Length:310 Identity:102/310 - (32%)
Similarity:139/310 - (44%) Gaps:117/310 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   284 MDHKLPLSFLGPPLAALHSMTTEMKGQGVGGSSASANGLSY-SHSPNSHLISDRGSGGSSSSSST 347
            |:...|.:||.||      .:||||          ::|..: :|:| .|.::....|....|.: 
 Frog     1 METHHPGAFLLPP------YSTEMK----------SSGCQFPAHTP-FHKLNPSVLGCHLPSGT- 47

  Fly   348 TTTNTNSQGAPNPHGIDTILSKPPPVTSAGL------------------------SALTGAGIPR 388
                        ||||..|||:|.|.:.:|:                        |.||.:|.| 
 Frog    48 ------------PHGISDILSRPLPASHSGMFPGYPTVQGYGSSSVPGSCYGEQGSILTKSGTP- 99

  Fly   389 FSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANPIAWR------ERLSNTMS 447
                        |.:||:|.                |..::.      .||      ..:|||  
 Frog   100 ------------YTNQSRGC----------------WTDIEQ------DWRGGNRALSSVSNT-- 128

  Fly   448 ANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKV 512
                         :...:||||||||:|.|||||||||||||||||||||:||::||||||||||
 Frog   129 -------------EGSSRKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAFSLGMSESQVKV 180

  Fly   513 WFQNRRTKWRKRHAAEM----ATAKRKQDDM--GGDNDGDCSETMDSDNE 556
            |||||||||||:.|.|.    :.:.|...|:  ..:.|.:.|:.:|.|::
 Frog   181 WFQNRRTKWRKKSAVETPGLPSLSTRGPGDLTPSENEDDEYSKPLDPDSD 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 30/128 (23%)
Homeobox 469..523 CDD:395001 48/53 (91%)
nkx6-3XP_002932753.1 Homeobox 137..190 CDD:278475 47/52 (90%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001882
OrthoInspector 1 1.000 - - otm49491
Panther 1 1.100 - - O PTHR24340
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.010

Return to query results.
Submit another query.