DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and dlx1

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001093727.1 Gene:dlx1 / 100101750 XenbaseID:XB-GENE-876850 Length:251 Species:Xenopus tropicalis


Alignment Length:297 Identity:66/297 - (22%)
Similarity:104/297 - (35%) Gaps:127/297 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 ESASPPPQGQ---NDYSPENLSSQRAKFQHHHGVNPLALHNANHAGNPGCHNNNNHMDHKLPLSF 292
            ||.|.|..|:   .::.|.|.....:...|.|                                 
 Frog     8 ESLSSPVSGKAVFMEFGPPNQQMPPSPMSHGH--------------------------------- 39

  Fly   293 LGPPLAALHSMTTEMKGQGVGGSSAS-ANGLSYSHSPNSHLISDRGSGGSSSSSSTTTTNTNSQG 356
                 .::|.:.::......|.||.| |.|..|.:|.:||                         
 Frog    40 -----YSMHCLHSQHDSSYSGASSFSRALGYPYVNSVSSH------------------------- 74

  Fly   357 APNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRT 421
            :.||: |.|:.|.|   .|:.||                                        :|
 Frog    75 SSNPY-ISTVQSYP---NSSSLS----------------------------------------QT 95

  Fly   422 HLYWPGLQGLVANPIAWRERLSNTMSANLSQSHQHHPSNDKDGKKKHTRPTFSGQQIFALEKTFE 486
            .|..||               :.|..:.:.:..:.. .|.|..|.:..|..:|..|:.||.:.|:
 Frog    96 RLEEPG---------------AETEKSTVVEGGEVR-FNGKGKKIRKPRTIYSSLQLQALNRRFQ 144

  Fly   487 QTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRK 523
            ||:|||.||||:||.:||::::|||:||||:|:|::|
 Frog   145 QTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKK 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 29/160 (18%)
Homeobox 469..523 CDD:395001 28/53 (53%)
dlx1NP_001093727.1 Homeobox 127..181 CDD:365835 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.