Sequence 1: | NP_001368954.1 | Gene: | HGTX / 53446 | FlyBaseID: | FBgn0040318 | Length: | 587 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001128284.1 | Gene: | emx2 / 100038069 | XenbaseID: | XB-GENE-481028 | Length: | 247 | Species: | Xenopus tropicalis |
Alignment Length: | 198 | Identity: | 51/198 - (25%) |
---|---|---|---|
Similarity: | 80/198 - (40%) | Gaps: | 73/198 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 402 LSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANP-IAWRERLS---------------NTMSAN- 449
Fly 450 LSQSHQHHP----------------------------SNDKDG-----------KKKHTRPTFSG 475
Fly 476 QQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMG 540
Fly 541 GDN 543 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
HGTX | NP_001368954.1 | ROM1 | 179..>388 | CDD:227709 | |
Homeobox | 469..523 | CDD:395001 | 28/53 (53%) | ||
emx2 | NP_001128284.1 | Homeobox | 153..206 | CDD:365835 | 28/62 (45%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |