DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and emx2

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:NP_001128284.1 Gene:emx2 / 100038069 XenbaseID:XB-GENE-481028 Length:247 Species:Xenopus tropicalis


Alignment Length:198 Identity:51/198 - (25%)
Similarity:80/198 - (40%) Gaps:73/198 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   402 LSQSQGAPLKTHAGHIVDRTHLYWPGLQGLVANP-IAWRERLS---------------NTMSAN- 449
            ||.:..||:......       :.|..:|:.:|| :.:.|.:|               :.::|: 
 Frog    36 LSYANSAPMNPFLNG-------FHPTGRGVYSNPDLVFAEAVSHPPNPAVPVHPVPPPHALAAHP 93

  Fly   450 LSQSHQHHP----------------------------SNDKDG-----------KKKHTRPTFSG 475
            |..||..||                            .||...           |.|..|..||.
 Frog    94 LPTSHSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSAESFLLHNALARKPKRIRTAFSP 158

  Fly   476 QQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKRKQDDMG 540
            .|:..||..||:..|:.|.||.:||::|.::|:||||||||||||::          ::|.::.|
 Frog   159 SQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKVWFQNRRTKFK----------RQKLEEEG 213

  Fly   541 GDN 543
            .|:
 Frog   214 SDS 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709
Homeobox 469..523 CDD:395001 28/53 (53%)
emx2NP_001128284.1 Homeobox 153..206 CDD:365835 28/62 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.