DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HGTX and LOC100008066

DIOPT Version :9

Sequence 1:NP_001368954.1 Gene:HGTX / 53446 FlyBaseID:FBgn0040318 Length:587 Species:Drosophila melanogaster
Sequence 2:XP_003199819.1 Gene:LOC100008066 / 100008066 -ID:- Length:251 Species:Danio rerio


Alignment Length:243 Identity:69/243 - (28%)
Similarity:103/243 - (42%) Gaps:53/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 PNPHGIDTILSKPPPVTSAGLSALTGAGIPRFSIAAAAAGMAQYLSQSQGAPLKTHAGHIVDRTH 422
            |...|||.||....|.:|.       .|.|..:......|::  |.:|         |.:...:.
Zfish    16 PIRFGIDQILGSAEPESSR-------LGSPNIAPHVPLPGVS--LEES---------GRVFGVSS 62

  Fly   423 LYWPGLQGLVA----NPIA-------------W--------RERLSNTMSANLSQSHQHHPSNDK 462
            ...||  |::.    .|:|             |        ::||...:...:::...|...|..
Zfish    63 ALLPG--GVIRVPAHRPLAPAMMSAAPALCFPWMDNNRRFPKDRLPALIPFTVTRRIGHPYQNRT 125

  Fly   463 DGKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAA 527
            ..|:|..|.:||..||..|||.|.:.||||..|||.||.:|.|:::|||.||||||||||::.|.
Zfish   126 PPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAE 190

  Fly   528 EMATAKRKQDDMGGDNDGDCSETMDSDNESLDMGESPAQNKRCRSNSS 575
            |....:::.:.|        ...:.:|.....:.||.:.:..|..|||
Zfish   191 EREAGRQQANRM--------LLQLQADALQKSISESVSSDPLCLHNSS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HGTXNP_001368954.1 ROM1 179..>388 CDD:227709 9/29 (31%)
Homeobox 469..523 CDD:395001 32/53 (60%)
LOC100008066XP_003199819.1 Homeobox 132..185 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.