DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc1b and lmgA

DIOPT Version :10

Sequence 1:NP_652613.1 Gene:Roc1b / 53445 FlyBaseID:FBgn0040291 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_001097122.1 Gene:lmgA / 5740853 FlyBaseID:FBgn0250903 Length:85 Species:Drosophila melanogaster


Alignment Length:85 Identity:31/85 - (36%)
Similarity:44/85 - (51%) Gaps:7/85 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RFVVKKWVAHAMWGWDVAVDNCAICRNHIMNLCIECQADPNANQDECTVAWGECNHAFHYHCIAR 100
            :..:|.|...|.|.|....:||.|||....:.|.|| |.|.   |:|.:.||.|:|.||.|||.:
  Fly     2 KVTIKSWTGVATWRWIANDENCGICRMSFESTCPEC-ALPG---DDCPLVWGVCSHCFHMHCIVK 62

  Fly   101 WLKTRLV---CPLDNKEWVY 117
            ||..:.:   ||:..:.|.:
  Fly    63 WLNLQPLNKQCPMCRQSWKF 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc1bNP_652613.1 mRING-H2-C3H2C2D_RBX1 55..115 CDD:438148 25/62 (40%)
lmgANP_001097122.1 RING_Ubox 1..82 CDD:473075 31/83 (37%)

Return to query results.
Submit another query.