DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Roc1b and Rnf7

DIOPT Version :10

Sequence 1:NP_652613.1 Gene:Roc1b / 53445 FlyBaseID:FBgn0040291 Length:122 Species:Drosophila melanogaster
Sequence 2:NP_035409.1 Gene:Rnf7 / 19823 MGIID:1337096 Length:113 Species:Mus musculus


Alignment Length:47 Identity:12/47 - (25%)
Similarity:16/47 - (34%) Gaps:23/47 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 VTVDDVHKAC--------ERFEELGV---------------EFAKKP 150
            ::.||.|..|        |:.|:|.|               |||..|
Mouse   390 LSADDDHLVCGCCDSTCGEQTEQLNVAPKWDAAFVGPISIKEFAYGP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Roc1bNP_652613.1 mRING-H2-C3H2C2D_RBX1 55..115 CDD:438148
Rnf7NP_035409.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
RING-H2_RBX2 47..106 CDD:438129
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.