DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and RBM39

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_909122.1 Gene:RBM39 / 9584 HGNCID:15923 Length:530 Species:Homo sapiens


Alignment Length:112 Identity:35/112 - (31%)
Similarity:52/112 - (46%) Gaps:15/112 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNGGGAGGLGAARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 65
            |:|....|..|..|          |.|.:|.:..|.:.||.:||..|.:..|.:..|..|..|:|
Human   238 MANNLQKGSAGPMR----------LYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKG 292

  Fly    66 FAFVRFYDKRDAEDALEAMDGRMLDGRELRVQMARYGRPSSPTRSSS 112
            :.|:.|.|...|:.|||.::|..|.||.::|     |..:..|.:||
Human   293 YGFITFSDSECAKKALEQLNGFELAGRPMKV-----GHVTERTDASS 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 25/71 (35%)
RBM39NP_909122.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..146
SF-CC1 46..518 CDD:273721 35/112 (31%)
Interaction with JUN. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..406 17/49 (35%)
Activating domain. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..355 17/49 (35%)
Interaction with ESR1 and ESR2. /evidence=ECO:0000250|UniProtKB:Q8VH51 355..406
Interaction with NCOA6. /evidence=ECO:0000250|UniProtKB:Q8VH51 406..530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.