DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and NSR1

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_011675.1 Gene:NSR1 / 853064 SGDID:S000003391 Length:414 Species:Saccharomyces cerevisiae


Alignment Length:179 Identity:49/179 - (27%)
Similarity:73/179 - (40%) Gaps:53/179 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRM 88
            :|.:.||::....:.:..:|.:.|||..:.||....|.:.:||.:|:|.:..||:.||:|:.|..
Yeast   268 TLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEY 332

  Fly    89 LDGRELRVQMARYGRPSSPTRSSSGRRG-----GGGGGGSGGRRRSRSRSPMRRRSRSPRRRSYS 148
            :|.|.:|:..      |||..::.|.||     ||.|||.||.|....                 
Yeast   333 IDNRPVRLDF------SSPRPNNDGGRGGSRGFGGRGGGRGGNRGFGG----------------- 374

  Fly   149 RSRSPGSHSPERRSKFSRSPVRGDSRNGIG----SGSGGLAPAASRSRS 193
                                 ||.:|.|.|    ||||.......|||:
Yeast   375 ---------------------RGGARGGRGGFRPSGSGANTAPLGRSRN 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 23/75 (31%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 23/71 (32%)
NSR1NP_011675.1 RRM1_gar2 169..244 CDD:409881
RRM2_gar2 269..341 CDD:409882 23/71 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S1239
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.