DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and CSTF64

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_177325.2 Gene:CSTF64 / 843510 AraportID:AT1G71800 Length:461 Species:Arabidopsis thaliana


Alignment Length:96 Identity:32/96 - (33%)
Similarity:48/96 - (50%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIY---IPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRM 88
            |.|:.|..|.|.||.:   |||||.:.   :..||.|.:.:|:.|..:.|:..|..|...:....
plant    13 VGNIPYDATEEQLREI---CGEVGPVVSFRLVTDRETGKPKGYGFCEYKDEETALSARRNLQSYE 74

  Fly    89 LDGRELRVQMARYGRPSSPTRSSSGRRGGGG 119
            ::||:|||..|...:.:..||..|  :||.|
plant    75 INGRQLRVDFAENDKGTDKTRDQS--QGGPG 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 24/72 (33%)
CSTF64NP_177325.2 RRM_CSTF2_RNA15_like 9..85 CDD:409832 25/74 (34%)
SF-CC1 <11..212 CDD:273721 32/96 (33%)
CSTF_C 419..454 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.