DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and AT1G22330

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_564168.2 Gene:AT1G22330 / 838839 AraportID:AT1G22330 Length:291 Species:Arabidopsis thaliana


Alignment Length:173 Identity:46/173 - (26%)
Similarity:84/173 - (48%) Gaps:20/173 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAM--DGRML 89
            |..|.:.|..:::||.|::.||:.:..|..|:.|.:|:|:.||.|   ||::.|..|:  ...::
plant    21 VGGLAWETPTDEMRRYFDQFGEILEAVIITDKATGKSKGYGFVTF---RDSDSATRAVADPNPVI 82

  Fly    90 DGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGS---GGRRRSRS--RSPMRRRSRSP---RRRS 146
            |||:....:|.:|||    |.|:.|..|.||..|   ||.:.|.:  .:|:::.:.:.   ....
plant    83 DGRKANCNIASFGRP----RPSTPRGRGQGGSPSQYQGGGQSSYTGMAAPVQQAAAAQLMYPSYG 143

  Fly   147 YSRSRSPGSHSPERRSKFSRSPVRGDSRNGIGSGSGGLAPAAS 189
            |:.:...|.|.....::..::........|   |.|..:|::|
plant   144 YTYNSEYGYHQALYNAQLQQAQYYQQQMYG---GGGATSPSSS 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 23/71 (32%)
AT1G22330NP_564168.2 RRM_RBM24_RBM38_like 17..92 CDD:409818 23/73 (32%)

Return to query results.
Submit another query.