DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and GR-RBP6

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_173298.1 Gene:GR-RBP6 / 838444 AraportID:AT1G18630 Length:155 Species:Arabidopsis thaliana


Alignment Length:170 Identity:48/170 - (28%)
Similarity:63/170 - (37%) Gaps:49/170 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IDGMVSLK-----VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAE 78
            :.|.:||.     |..|:..|..|.|:..|...|::.|..:..||.:..||||.||.:.....|.
plant    27 LQGNLSLTPSKIFVGGLSPSTDVELLKEAFGSFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVAN 91

  Fly    79 DALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRRRSRSPR 143
            :|::||..:.||||.:.|..|..|             |||||||..           ||......
plant    92 NAMQAMQNKELDGRIIGVHPADSG-------------GGGGGGGFA-----------RRGGYGGG 132

  Fly   144 RRSYSRSRSPGSHSPERRSKFSRSPVRGDSRNGIGSGSGG 183
            |..|:|.                    |..|.|.|.|..|
plant   133 RGGYARG--------------------GFGRGGFGGGGYG 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 25/76 (33%)
GR-RBP6NP_173298.1 RRM 37..109 CDD:214636 24/71 (34%)

Return to query results.
Submit another query.