DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and UBP1B

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_564018.1 Gene:UBP1B / 838309 AraportID:AT1G17370 Length:419 Species:Arabidopsis thaliana


Alignment Length:71 Identity:24/71 - (33%)
Similarity:38/71 - (53%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 VFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDGRELRVQMARYGRPSS 106
            |:..|   .|..:..|:.|..||||.||.|.:::||:.|::.:.|:.|..|::|...|..|..|.
plant   161 VYPTC---SDARVMWDQKTGRSRGFGFVSFRNQQDAQTAIDEITGKWLGSRQIRCNWATKGATSG 222

  Fly   107 PTRSSS 112
            ..:.||
plant   223 EDKQSS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 19/54 (35%)
UBP1BNP_564018.1 RRM1_PUB1 56..126 CDD:410026
RRM2_PUB1 138..217 CDD:410031 20/58 (34%)
RRM3_PUB1 260..336 CDD:410033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.