DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and SC35

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_201225.1 Gene:SC35 / 836541 AraportID:AT5G64200 Length:303 Species:Arabidopsis thaliana


Alignment Length:205 Identity:92/205 - (44%)
Similarity:113/205 - (55%) Gaps:49/205 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNGGGAGGLGAARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRG 65
            ||:.|.:|       ||.|....||.|.|:|:|||.:||..:|.:.|:|.|::|||||.|.:|||
plant     1 MSHFGRSG-------PPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRG 58

  Fly    66 FAFVRFYDKRDAEDALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGR---- 126
            |||||:..|.:|..|:|.:|||::||||:.||.|:|| |::...|.             ||    
plant    59 FAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYG-PNAEKISK-------------GRVVEP 109

  Fly   127 ----RRSRSRSPMRRRSRSPRR-RSYSRSRSP-GSHSPERRSKFSRSPVRGDSRNGIGSGSGGLA 185
                ||||||||  |||||||| ||..|.||| .|.||.|||       |.|.|.         .
plant   110 PPKSRRSRSRSP--RRSRSPRRSRSPPRRRSPRRSRSPRRRS-------RDDYRE---------K 156

  Fly   186 PAASRSRSRS 195
            ....||||||
plant   157 DYRKRSRSRS 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 41/75 (55%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 38/71 (54%)
SC35NP_201225.1 RRM_SRSF2_SRSF8 18..90 CDD:409751 36/71 (51%)
PHA03307 <204..>303 CDD:223039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 79 1.000 Domainoid score I3035
eggNOG 1 0.900 - - E1_KOG4207
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003650
OrthoInspector 1 1.000 - - oto3679
orthoMCL 1 0.900 - - OOG6_104633
Panther 1 1.100 - - LDO PTHR23147
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3014
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.770

Return to query results.
Submit another query.