DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and AT5G59860

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_200794.1 Gene:AT5G59860 / 836108 AraportID:AT5G59860 Length:157 Species:Arabidopsis thaliana


Alignment Length:94 Identity:29/94 - (30%)
Similarity:52/94 - (55%) Gaps:9/94 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IDGMVSLKVDN--LTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDAL 81
            |.|.....|.|  |:..||.:.||::|.....     :.:|:.|:..:||.|:.|..:.||:.||
plant    65 IGGKTLTCVSNSGLSAYTTDQSLRQLFAPFAR-----LIKDQQTQRPKGFGFITFESEDDAQKAL 124

  Fly    82 EAMDGRMLDGRELRVQMARYGRPSSPTRS 110
            :|::|::::||.:.|:.|:  ...:||.|
plant   125 KALNGKIVNGRLIFVETAK--EVEAPTTS 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 22/73 (30%)
AT5G59860NP_200794.1 RRM 73..144 CDD:440488 24/77 (31%)

Return to query results.
Submit another query.