DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and Cstf2t

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_112539.2 Gene:Cstf2t / 83410 MGIID:1932622 Length:632 Species:Mus musculus


Alignment Length:33 Identity:11/33 - (33%)
Similarity:18/33 - (54%) Gaps:2/33 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 STAEIIAA-QSQDYVDEKLAEY-QATIMLLQGE 284
            :||.:.|| :.|..:.|||..: ...:.|:|.|
Mouse   130 ATAAVTAATKGQGVLSEKLRSFSMQDLTLIQNE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751
Cstf2tNP_112539.2 RRM_CSTF2_CSTF2T 10..94 CDD:410072
CSTF2_hinge 112..191 CDD:433869 11/33 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..296
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..433
8 X 5 AA tandem repeats of M-E-T-R-[AG] 428..466
12 X 5 AA tandem repeats of G-[AT]-G-[MI]-Q 508..565
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 519..590
CSTF_C 588..628 CDD:464130
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.