DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and AT5G19350

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_197436.1 Gene:AT5G19350 / 832055 AraportID:AT5G19350 Length:425 Species:Arabidopsis thaliana


Alignment Length:180 Identity:41/180 - (22%)
Similarity:79/180 - (43%) Gaps:37/180 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PPRID-GMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAED 79
            ||..| ...::.|.||....|.|:|::.|.:.|||..:.||      .::|:.:|:|..:..||:
plant   229 PPESDVTCTTISVANLDQNVTEEELKKAFSQLGEVIYVKIP------ATKGYGYVQFKTRPSAEE 287

  Fly    80 ALEAMDGRMLDGRELRVQMARY-GRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRRRSRSPR 143
            |::.|.|:::..:.:|:..::. |:....|::...:..|..|.|.|                 ..
plant   288 AVQRMQGQVIGQQAVRISWSKNPGQDGWVTQADPNQWNGYYGYGQG-----------------YD 335

  Fly   144 RRSYSRSRSP-----GSHSPERRSKFSRSPVRGDSRNGI-GSGSGGLAPA 187
            ..:|..::.|     |.:.      :.:.|.:|:....| .|.:||:|.|
plant   336 AYAYGATQDPSVYAYGGYG------YPQYPQQGEGTQDISNSAAGGVAGA 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 21/71 (30%)
AT5G19350NP_197436.1 RRM1_SECp43_like 25..105 CDD:409780
RRM2_SECp43_like 115..194 CDD:409781
RRM_SF 237..306 CDD:473069 21/74 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.