DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and SCL28

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_197382.3 Gene:SCL28 / 831999 AraportID:AT5G18810 Length:236 Species:Arabidopsis thaliana


Alignment Length:201 Identity:76/201 - (37%)
Similarity:100/201 - (49%) Gaps:23/201 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RPPPR---IDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKR 75
            ||..|   ..|...|.:.||.....|.|||..|||.|.:.|||:||:.||.|.|||.||::....
plant    35 RPSSRDHESSGPSGLLIRNLPLDARPNDLRDSFERFGPLKDIYLPRNYYTGEPRGFGFVKYRYAE 99

  Fly    76 DAEDALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRR--- 137
            ||.:|::.|:.:::.|||:.:..|...| .:|...   |...|..|..|..:|:..|||.||   
plant   100 DAAEAMKRMNHKVIGGREIAIVFAEENR-KTPQEM---RTTNGTSGRHGDYKRTSHRSPRRRYRS 160

  Fly   138 --RSRSPRRRS--YSRSRSPGSHSPERRSK-FSRSPVRGDSRNGIGSGSGG------LAPAASR- 190
              |||||.||.  :|:.|....:||.|||: .||||:..:.|.........      |.|..|| 
plant   161 HSRSRSPPRRESRHSKVREDDLYSPRRRSRSISRSPLPRNEREYKSRNCRSPREERVLTPIRSRC 225

  Fly   191 -SRSRS 195
             |||||
plant   226 LSRSRS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 31/75 (41%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 31/71 (44%)
SCL28NP_197382.3 RRM <23..>134 CDD:223796 38/102 (37%)
RRM_SF 47..130 CDD:302621 33/83 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I2005
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
22.010

Return to query results.
Submit another query.