DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and AT5G06210

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_196239.1 Gene:AT5G06210 / 830508 AraportID:AT5G06210 Length:146 Species:Arabidopsis thaliana


Alignment Length:103 Identity:34/103 - (33%)
Similarity:53/103 - (51%) Gaps:13/103 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GMVS-LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAM 84
            |:.| |.:..|::.||.:.|...|.:||:|.:..|..||.:..|:||.||.|....:|:.||...
plant    31 GVASKLFIGGLSFCTTEQGLSEAFSKCGQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEF 95

  Fly    85 DGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGG 122
            :|:.|:||.:.|..|:            .::..|||||
plant    96 NGQQLNGRTIFVDYAK------------AKQSLGGGGG 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 25/71 (35%)
AT5G06210NP_196239.1 RRM_SF 34..113 CDD:473069 28/90 (31%)

Return to query results.
Submit another query.