DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and RSZ22

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001078474.1 Gene:RSZ22 / 829285 AraportID:AT4G31580 Length:200 Species:Arabidopsis thaliana


Alignment Length:213 Identity:74/213 - (34%)
Similarity:93/213 - (43%) Gaps:52/213 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 MVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDG 86
            |..:.|.||..|.|..:|...|...|.|..:::     .|...|:||:.|.|.|||.||:.|:||
plant     1 MSRVYVGNLDPRVTERELEDEFRAFGVVRSVWV-----ARRPPGYAFLDFEDPRDARDAIRALDG 60

  Fly    87 RMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGG---------------------------GSG 124
            :    ...||:.: :.|.........|.|||||||                           |..
plant    61 K----NGWRVEQS-HNRGERGGGGRGGDRGGGGGGRGGRGGSDLKCYECGETGHFARECRNRGGT 120

  Fly   125 GRRRSRSRS---PMRRRSRSPRRRSYS-RSRSP-------GSHSPERRSKFSRSPVRGDSRNGIG 178
            |||||:|||   |..|||.|..||||| |:|||       .|..|.|...:||||....:|..:.
plant   121 GRRRSKSRSRTPPRYRRSPSYGRRSYSPRARSPPPPRRRSPSPPPARGRSYSRSPPPYRAREEVP 185

  Fly   179 SGSG-GLAPAASRSRSRS 195
            ..:| ||   ..|.||||
plant   186 YANGNGL---KERRRSRS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 25/75 (33%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 24/71 (34%)
RSZ22NP_001078474.1 RRM_SRSF3_like 3..71 CDD:409808 25/77 (32%)
zf-CCHC 100..114 CDD:395050 0/13 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.