DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and RBP31

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_194208.1 Gene:RBP31 / 828579 AraportID:AT4G24770 Length:329 Species:Arabidopsis thaliana


Alignment Length:107 Identity:35/107 - (32%)
Similarity:53/107 - (49%) Gaps:12/107 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ARP--PPRI-DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDK 74
            :||  .||: :....:.|.||.:......|.::|...|:|.:..:..||.|..||||.||...|.
plant   231 SRPERAPRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHGKVVEARVVYDRETGRSRGFGFVTMSDV 295

  Fly    75 RDAEDALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRG 116
            .:..:|:.|:||:.|:||.:||.:|....|         |||
plant   296 DELNEAISALDGQNLEGRAIRVNVAEERPP---------RRG 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 25/71 (35%)
RBP31NP_194208.1 DNA_pol_phi <87..150 CDD:461488
RRM1_PSRP2_like 151..230 CDD:410188
RRM 245..327 CDD:440488 28/90 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.