DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and AT4G20030

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_567594.1 Gene:AT4G20030 / 827748 AraportID:AT4G20030 Length:152 Species:Arabidopsis thaliana


Alignment Length:95 Identity:31/95 - (32%)
Similarity:53/95 - (55%) Gaps:8/95 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRML 89
            :.|.||.:.|:.:.|:|.|...||:.::.:.:|...:.|:|:||::|..:.||..|:|.||.||.
plant    42 IMVRNLPFSTSEDFLKREFSAFGEIAEVKLIKDEAMKRSKGYAFIQFTSQDDAFLAIETMDRRMY 106

  Fly    90 DGRELRVQMARYG--------RPSSPTRSS 111
            :||.:.:.:|:.|        |.|.|...|
plant   107 NGRMIYIDIAKPGKRDFQGLPRTSGPPEKS 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 25/71 (35%)
AT4G20030NP_567594.1 RRM 41..113 CDD:214636 25/70 (36%)

Return to query results.
Submit another query.