DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and SCL30

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_567021.1 Gene:SCL30 / 824712 AraportID:AT3G55460 Length:262 Species:Arabidopsis thaliana


Alignment Length:220 Identity:90/220 - (40%)
Similarity:105/220 - (47%) Gaps:44/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 GAGGLGAARPPP---------------RIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIP 55
            |.||.|.:.|||               |.....||.|.|:.....||:||..|||.|.|.|:|||
plant    15 GYGGRGRSPPPPPPRRGYGGGGGGGGRRGSSHGSLLVRNIPLDCRPEELREPFERFGPVRDVYIP 79

  Fly    56 RDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDGRELRVQMARYG--RPSS---PTRSSSGRR 115
            ||.|:.:.||||||.|.|..||.:|..:|:.|...|||:.|.:|...  ||..   .||:.| |.
plant    80 RDYYSGQPRGFAFVEFVDAYDAGEAQRSMNRRSFAGREITVVVASESRKRPEEMRVKTRTRS-RE 143

  Fly   116 GGGGGGGSGGRRRSRSRSPMRRRSRSPRRRSYSRSR------SPGSHSPERRSKFSRSPVRGD-- 172
            ..|....|.||.||||.|    |||||||.|.||||      ||   :|.||.    .|.||:  
plant   144 PSGSRDRSHGRSRSRSIS----RSRSPRRPSDSRSRYRSRSYSP---APRRRG----GPPRGEED 197

  Fly   173 ---SRNGIGSGSGGLAPAA-SRSRS 193
               ||.....|..|.|.|| .|.|:
plant   198 ENYSRRSYSPGYEGAAAAAPDRDRN 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 37/75 (49%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 35/71 (49%)
SCL30NP_567021.1 RRM 49..120 CDD:214636 35/70 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I2005
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
33.010

Return to query results.
Submit another query.