DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and CP29

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001190079.1 Gene:CP29 / 824514 AraportID:AT3G53460 Length:363 Species:Arabidopsis thaliana


Alignment Length:188 Identity:56/188 - (29%)
Similarity:73/188 - (38%) Gaps:39/188 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDG- 86
            :.|.|.||::......|.::||..|.|..:.:..|:.|..||||.||......:.|.|.:..:| 
plant    99 LKLFVGNLSFNVDSAQLAQLFESAGNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVEAAAQQFNGY 163

  Fly    87 ---------------RML-----DGRELRVQMARYGRPSSPTRSSS---GRRGGG----GGGGSG 124
                           |:|     :||.|||...    |..|.|..|   |.|.||    .|||.|
plant   164 VSRYLCSLLCLYLLIRVLCGLEFEGRPLRVNAG----PPPPKREESFSRGPRSGGYGSERGGGYG 224

  Fly   125 GRRRSRSRSPMRRRSRSPRRRSYSRSRSPGSHSPERRSKFSRSPVRGDSRNGIGSGSG 182
            ..|.....|.......|.|...|...||.|.:...:||.:.       |.:|.|||||
plant   225 SERGGGYGSERGGGYGSERGGGYGSQRSGGGYGGSQRSSYG-------SGSGSGSGSG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 26/92 (28%)
CP29NP_001190079.1 U2AF_lg <45..>144 CDD:273727 15/44 (34%)
RRM_SF 100..199 CDD:473069 28/102 (27%)
RRM 278..361 CDD:440488
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.