DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and U1-70K

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_190636.1 Gene:U1-70K / 824230 AraportID:AT3G50670 Length:427 Species:Arabidopsis thaliana


Alignment Length:219 Identity:62/219 - (28%)
Similarity:89/219 - (40%) Gaps:48/219 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 DGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAM 84
            |...:|.|..|.|.::...::|.||..|.:..:::..|:.|.:.:|:||:.:...||.:.|.:..
plant   135 DPYKTLFVSRLNYESSESKIKREFESYGPIKRVHLVTDQLTNKPKGYAFIEYMHTRDMKAAYKQA 199

  Fly    85 DGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGS---GG--------------------- 125
            ||:.:|||.:.|.:.| ||.....|.   ||.|||.|.|   ||                     
plant   200 DGQKIDGRRVLVDVER-GRTVPNWRP---RRLGGGLGTSRVGGGEEIVGEQQPQGRTSQSEEPSR 260

  Fly   126 ----RRRSRSRSPMRRRSR-----SPRRRS--------YSRSRSPGSHSPERRSKFSRSPV--RG 171
                |.:||.:...|.|||     .||.||        :.|.|..|....:|.|:..|...  ||
plant   261 PREEREKSREKGKERERSRELSHEQPRERSRDRPREDKHHRDRDQGGRDRDRDSRRDRDRTRDRG 325

  Fly   172 D-SRNGIGSGSGGLAPAASRSRSR 194
            | .|.....|....:....|.|||
plant   326 DRDRRDRDRGRDRTSRDHDRDRSR 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 21/71 (30%)
U1-70KNP_190636.1 U1snRNP70_N 40..129 CDD:432406
RRM_snRNP70 137..227 CDD:409682 27/93 (29%)
PRK12678 245..>395 CDD:237171 26/105 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.