DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and AT3G14100

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_188026.1 Gene:AT3G14100 / 820626 AraportID:AT3G14100 Length:427 Species:Arabidopsis thaliana


Alignment Length:164 Identity:40/164 - (24%)
Similarity:64/164 - (39%) Gaps:33/164 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDG 91
            |.:|:...|...|.:.|.......|..:..|:.|..||||.||.|.:::||:.|:..|:|:.|..
plant   148 VGDLSPEVTDATLYQSFSVFSSCSDARVMWDQKTGRSRGFGFVSFRNQQDAQTAINEMNGKWLSS 212

  Fly    92 RELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRRRSRSPRRRSYSRSRSPGSH 156
            |::|...|..|..|...:.||.                 .:|.:...:.|    |.....:....
plant   213 RQIRCNWATKGATSGDDKLSSD-----------------GKSVVELTTGS----SEDGKETLNEE 256

  Fly   157 SPERRSKFSRSPVRGDSRNGIGSGSGGLAPAASR 190
            :||..|:|:...|            |.|||..::
plant   257 TPENNSQFTTVYV------------GNLAPEVTQ 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 23/69 (33%)
AT3G14100NP_188026.1 RRM1_PUB1 61..131 CDD:410026
RRM2_PUB1 143..222 CDD:410031 24/73 (33%)
RRM_SF 265..341 CDD:473069 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.