DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and EIF3G1

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001154607.1 Gene:EIF3G1 / 820313 AraportID:AT3G11400 Length:321 Species:Arabidopsis thaliana


Alignment Length:115 Identity:38/115 - (33%)
Similarity:52/115 - (45%) Gaps:18/115 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSNGGGAGGLGAARPPP----------------RIDGMVSLKVDNLTYRTTPEDLRRVFERCGEV 49
            ||...|.|  .||..||                |.:...|::|.||:..|...||..:|...|.|
plant   204 MSAAPGTG--KAAYVPPSMRAGADRSAVGSDMRRRNDENSVRVTNLSEDTREPDLMELFHPFGAV 266

  Fly    50 GDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDGRELRVQMA 99
            ..:|:..|:.|..||||.||.|..:.||:.|:..::|...|...|||:.|
plant   267 TRVYVAIDQKTGVSRGFGFVNFVSREDAQRAINKLNGYGYDNLILRVEWA 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 26/71 (37%)
EIF3G1NP_001154607.1 eIF3g 31..186 CDD:463545
RRM_eIF3G_like 241..316 CDD:409842 28/74 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.