DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and U11/U12-31K

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_187651.1 Gene:U11/U12-31K / 820203 AraportID:AT3G10400 Length:261 Species:Arabidopsis thaliana


Alignment Length:103 Identity:39/103 - (37%)
Similarity:60/103 - (58%) Gaps:9/103 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGGAGGLGAARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAF 68
            |||:|||..::.        :|.|.||.:..|..|:..:|...|:|..:.:.:||:||:|||.||
plant    46 GGGSGGLAPSKS--------TLYVSNLDFSLTNSDIHTLFSTFGKVARVTVLKDRHTRQSRGVAF 102

  Fly    69 VRFYDKRDAEDALEAMDGRMLDGRELRVQMAR-YGRPS 105
            |.:..:.||..|..:||.::|:||:|.|.:|. .||.|
plant   103 VLYVSREDAAKAARSMDAKILNGRKLTVSIAADNGRAS 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 28/71 (39%)
U11/U12-31KNP_187651.1 RRM_ZCRB1 56..131 CDD:409827 28/82 (34%)
PTZ00368 154..>173 CDD:173561
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.