DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and AT3G08000

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_187457.1 Gene:AT3G08000 / 819991 AraportID:AT3G08000 Length:143 Species:Arabidopsis thaliana


Alignment Length:75 Identity:29/75 - (38%)
Similarity:43/75 - (57%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRML 89
            |.:..|::....:.|:..|...|||.::.|..|:.:..||||.||.|.::.||..|.:||||:.|
plant    43 LFIGGLSWSVDEQSLKDAFSSFGEVAEVRIAYDKGSGRSRGFGFVDFAEEGDALSAKDAMDGKGL 107

  Fly    90 DGRELRVQMA 99
            .||.||:..|
plant   108 LGRPLRISFA 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 28/71 (39%)
AT3G08000NP_187457.1 RRM 42..124 CDD:440488 29/75 (39%)

Return to query results.
Submit another query.