DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and AT2G21440

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_565513.1 Gene:AT2G21440 / 816683 AraportID:AT2G21440 Length:1003 Species:Arabidopsis thaliana


Alignment Length:101 Identity:34/101 - (33%)
Similarity:54/101 - (53%) Gaps:5/101 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRML 89
            |.:.||.::..|.|::.||...|.|.|::||::..|...:|||||:|..|:||.:|::..:|.|.
plant   333 LIIRNLPFQAKPSDIKVVFSAVGFVWDVFIPKNFETGLPKGFAFVKFTCKKDAANAIKKFNGHMF 397

  Fly    90 DGRELRVQMA-----RYGRPSSPTRSSSGRRGGGGG 120
            ..|.:.|..|     ..|...:.|.|:.|.:.|..|
plant   398 GKRPIAVDWAVPKNIYNGAADATTASADGDKEGSDG 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 26/71 (37%)
AT2G21440NP_565513.1 RRM1_RBM28_like 21..99 CDD:409847
ELAV_HUD_SF 24..411 CDD:273741 28/77 (36%)
RRM2_RBM28_like 332..408 CDD:409848 27/74 (36%)
RRM3_RBM28_like 561..642 CDD:409849
RRM4_RBM28_like 713..810 CDD:409850
PTZ00121 <813..>968 CDD:173412
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.