DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and TIAL1

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001029097.1 Gene:TIAL1 / 7073 HGNCID:11804 Length:392 Species:Homo sapiens


Alignment Length:81 Identity:30/81 - (37%)
Similarity:49/81 - (60%) Gaps:1/81 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDG 91
            |.:|:...|.||::..|...|::.|..:.:|..|.:|:|:.||.||:|.|||:|:..|.|:.|.|
Human   118 VGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGG 182

  Fly    92 RELRVQMARYGRPSSP 107
            |::|...|. .:|.:|
Human   183 RQIRTNWAT-RKPPAP 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 27/69 (39%)
TIAL1NP_001029097.1 RRM1_TIAR 10..107 CDD:410028
RRM2_TIAR 113..192 CDD:410029 28/74 (38%)
RRM3_TIAR 222..294 CDD:241064
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.