DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and SRSF3

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_003008.1 Gene:SRSF3 / 6428 HGNCID:10785 Length:164 Species:Homo sapiens


Alignment Length:191 Identity:67/191 - (35%)
Similarity:82/191 - (42%) Gaps:66/191 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDG 91
            |.||.......:|.|.|...|.:..:::     .|...|||||.|.|.|||.||:..:|||.|.|
Human    14 VGNLGNNGNKTELERAFGYYGPLRSVWV-----ARNPPGFAFVEFEDPRDAADAVRELDGRTLCG 73

  Fly    92 RELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSP-----------MRRRS-----R 140
            ..:||::                        |.|.:|||:|.|           .||||     |
Human    74 CRVRVEL------------------------SNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRR 114

  Fly   141 SPRRRSYSRSRSPGSHSPERRSKFSRS------PVRGDSRNGIGSGSGGLAPAASRSRSRS 195
            ||||||:||||| .|.|.:||.:.|.|      |.|..||              |||||||
Human   115 SPRRRSFSRSRS-RSLSRDRRRERSLSRERNHKPSRSFSR--------------SRSRSRS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 27/72 (38%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 26/69 (38%)
SRSF3NP_003008.1 Sufficient for interaction with NXF1 1..90 32/104 (31%)
RRM_SRSF3 6..86 CDD:241089 29/100 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..164 40/95 (42%)
2 X approximate repeats, basic 119..164 24/57 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.