DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and CG34334

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001097042.1 Gene:CG34334 / 5740122 FlyBaseID:FBgn0263829 Length:708 Species:Drosophila melanogaster


Alignment Length:189 Identity:61/189 - (32%)
Similarity:82/189 - (43%) Gaps:43/189 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYT-RESRGFAFVRFYDKRDA 77
            |.|.|   .|.|.:..||.:.|.|.:..:|...|.:..:..|.||:. |:.||:|||.:....|.
  Fly   529 RQPVR---NVRLHIKGLTRQVTKEHITEIFGHFGALTAVDFPMDRFQGRQGRGYAFVEYSRPEDC 590

  Fly    78 EDALEAMDGRMLDGRELRV-------------QMARY------------------GRPSSPTRSS 111
            ..|::.|:|..:||:.:||             |..||                  .|..||:||:
  Fly   591 ASAIKHMNGGQIDGKLIRVSAFQESMLKAPWRQYRRYSPVNRRQSQRTLSRSGSSSRSRSPSRSA 655

  Fly   112 SGRRGGGGGGGSGGRRRSRSRSPMRRRSRSPRRRSYSRSRSP--GSHSPERRSKFSRSP 168
            ||...|.....|..|..|.||...|.||:|   .||:|| ||  |.:...||.  ||||
  Fly   656 SGSEYGSRSSHSRVRSMSGSRYSRRNRSQS---CSYTRS-SPRYGHYHRPRRD--SRSP 708

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 25/89 (28%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 24/85 (28%)
CG34334NP_001097042.1 RRM 427..>610 CDD:223796 27/83 (33%)
RRM_RNPS1 537..610 CDD:240811 23/72 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1169
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.