DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and RBM23

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001339693.1 Gene:RBM23 / 55147 HGNCID:20155 Length:483 Species:Homo sapiens


Alignment Length:76 Identity:28/76 - (36%)
Similarity:44/76 - (57%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMD 85
            |.:.|.|.:|.:..|.:.||.:||..|::.:|.:.:|..|..|:|:.|:.|.|...|..|||.::
Human   305 GPMRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMKDSDTGRSKGYGFITFSDSECARRALEQLN 369

  Fly    86 GRMLDGRELRV 96
            |..|.||.:||
Human   370 GFELAGRPMRV 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 27/72 (38%)
RBM23NP_001339693.1 SF-CC1 143..482 CDD:273721 28/76 (37%)

Return to query results.
Submit another query.