DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and zcrb1

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001017589.2 Gene:zcrb1 / 550251 ZFINID:ZDB-GENE-041210-114 Length:218 Species:Danio rerio


Alignment Length:93 Identity:25/93 - (26%)
Similarity:51/93 - (54%) Gaps:8/93 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGGLGAARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRF 71
            :|||..::.        ::.|.|:.:..|..|:.::..:.|:|..:.|.:|::||.|:|.|||.|
Zfish     2 SGGLAPSKS--------TVYVSNIPFSLTNSDMHKLCSKYGKVVKVTIVKDKHTRMSKGVAFVLF 58

  Fly    72 YDKRDAEDALEAMDGRMLDGRELRVQMA 99
            .|:..|.:...:::.:.|.||.::..:|
Zfish    59 LDRESAYNCSRSLNNKQLFGRMVKASIA 86

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 21/71 (30%)
zcrb1NP_001017589.2 RRM_ZCRB1 9..84 CDD:409827 21/82 (26%)
PTZ00368 107..>126 CDD:173561
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 122..218
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.