DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and rnps1

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001015956.1 Gene:rnps1 / 548710 XenbaseID:XB-GENE-941526 Length:284 Species:Xenopus tropicalis


Alignment Length:169 Identity:57/169 - (33%)
Similarity:77/169 - (45%) Gaps:45/169 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRY-TRESRGFAFVRFYDKRDAE 78
            |.||   ...:.:..||...|.:.:..:|...|::..|.:|.||| ...|:|:|:|.|....:||
 Frog   134 PSPR---PTKVHIGRLTRNVTKDHILEIFSTYGKIKMIDMPVDRYHPHLSKGYAYVEFEAPEEAE 195

  Fly    79 DALEAMDGRMLDGRE-----------LRVQMARYGRP-----------SSPTRSSSGRRGGGGGG 121
            .||:.|||..:||:|           :|....|:..|           .||.|.           
 Frog   196 KALKHMDGGQIDGQEITASAVLTPWPMRAMPRRFSPPRRMLPPPPMWRRSPPRM----------- 249

  Fly   122 GSGGRRRSRS---RSPMRRRSRSPRRRSYSRSRSPGSHS 157
                ||||||   |||:|||||||.||.: ||||..:.|
 Frog   250 ----RRRSRSPRRRSPVRRRSRSPARRRH-RSRSSSNSS 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 26/87 (30%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 26/83 (31%)
rnps1NP_001015956.1 RRM <118..>211 CDD:223796 27/79 (34%)
RRM_RNPS1 141..214 CDD:240811 25/72 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1169
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.