DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and Pabpn1

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_062275.1 Gene:Pabpn1 / 54196 MGIID:1859158 Length:302 Species:Mus musculus


Alignment Length:167 Identity:51/167 - (30%)
Similarity:72/167 - (43%) Gaps:35/167 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PPPRIDGMV-------------SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGF 66
            |||...|.|             |:.|.|:.|..|.|:|...|..||.|..:.|..|:::...:||
Mouse   147 PPPGNAGPVIMSLEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGF 211

  Fly    67 AFVRFYDKRDAEDALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRS 131
            |::.|.||.....:| |:|..:..||:::|...|..||...|..    ||       ..|.|.|:
Mouse   212 AYIEFSDKESVRTSL-ALDESLFRGRQIKVIPKRTNRPGISTTD----RG-------FPRSRYRA 264

  Fly   132 RSPMRRRSRS---------PRRRSY-SRSRSPGSHSP 158
            |:.....|||         ||.|.| .|:|:...:||
Mouse   265 RTTNYNSSRSRFYSGFNSRPRGRIYRGRARATSWYSP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 23/71 (32%)
Pabpn1NP_062275.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..111
Interaction with SKIP. /evidence=ECO:0000250 2..141
Stimulates PAPOLA. /evidence=ECO:0000250 115..143
RRM_II_PABPN1 169..244 CDD:409966 25/75 (33%)
Strong poly(A) affinity and self-association. /evidence=ECO:0000250 255..302 17/54 (31%)
Interaction with PAPOLA. /evidence=ECO:0000250 282..302 8/20 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.