DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and RBM11

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001307531.1 Gene:RBM11 / 54033 HGNCID:9897 Length:288 Species:Homo sapiens


Alignment Length:87 Identity:28/87 - (32%)
Similarity:40/87 - (45%) Gaps:4/87 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDG 91
            |.||..|...|.|..:|.:.|.:..:.|.:|| ..:.:.|.||.|........|:..::|..|.|
Human    14 VGNLEARVREEILYELFLQAGPLTKVTICKDR-EGKPKSFGFVCFKHPESVSYAIALLNGIRLYG 77

  Fly    92 RELRVQMARYG--RPSSPTRSS 111
            |.:.||. |:|  |.|.|...|
Human    78 RPINVQY-RFGSSRSSEPANQS 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 20/69 (29%)
RBM11NP_001307531.1 RRM_RBM11 9..83 CDD:410006 20/69 (29%)
PABP-1234 <12..223 CDD:130689 28/87 (32%)

Return to query results.
Submit another query.