Sequence 1: | NP_001188794.1 | Gene: | SC35 / 53444 | FlyBaseID: | FBgn0265298 | Length: | 195 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001247139.1 | Gene: | SF2 / 53443 | FlyBaseID: | FBgn0283477 | Length: | 255 | Species: | Drosophila melanogaster |
Alignment Length: | 249 | Identity: | 66/249 - (26%) |
---|---|---|---|
Similarity: | 82/249 - (32%) | Gaps: | 123/249 - (49%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDG 91
Fly 92 RELRVQMARYGRPSS--------PTRSSSGRRG-------------------------------- 116
Fly 117 ----------------------------------------------------------------- 116
Fly 117 -GGGGGGSGG------RRRSRSRS----PMRR--RSRSP-RRRSYSRSRSPGSH 156 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SC35 | NP_001188794.1 | RRM | <24..>100 | CDD:223796 | 28/72 (39%) |
RRM_SRSF2_SRSF8 | 25..97 | CDD:240757 | 27/69 (39%) | ||
SF2 | NP_001247139.1 | RRM_SF | 3..80 | CDD:418427 | 28/72 (39%) |
RRM2_SRSF1_like | 115..188 | CDD:410013 | 0/72 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23147 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |