DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and RBMXL1

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_062556.2 Gene:RBMXL1 / 494115 HGNCID:25073 Length:390 Species:Homo sapiens


Alignment Length:196 Identity:69/196 - (35%)
Similarity:90/196 - (45%) Gaps:46/196 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRML 89
            |.:..|...|..:.|..||.:.|.:.::.:.:||.|.:|||||||.|....||:||...|:|:.|
Human    10 LFIGGLNTETNEKALETVFGKYGRIVEVLLIKDRETNKSRGFAFVTFESPADAKDAARDMNGKSL 74

  Fly    90 DGRELRVQMA--------RYGRPSSPTRSSSGRRG-GGGGGGSGGRR------------------ 127
            ||:.::|:.|        |:| |..|.||....|| |.|.|||||.|                  
Human    75 DGKAIKVEQATKPSFERGRHG-PPPPPRSRGPPRGFGAGRGGSGGTRGPPSRGGHMDDGGYSMNF 138

  Fly   128 -RSRSRSPMRRRSRSPRRRSYSRSRSPGSHSPERRSKFSRSPVRGDSRNGIGSGSGGLAPAASRS 191
             .|.||.|:..: |.|..||       |..||:      ||...|..|:  .||.||.|| .||.
Human   139 NMSSSRGPLPVK-RGPPPRS-------GGPSPK------RSAPSGLVRS--SSGMGGRAP-LSRG 186

  Fly   192 R 192
            |
Human   187 R 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 27/71 (38%)
RBMXL1NP_062556.2 RRM_RBMX_like 7..86 CDD:409816 29/75 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 62..390 50/144 (35%)
dnaA 165..>306 CDD:455861 12/26 (46%)
RBM1CTR 173..217 CDD:400429 9/18 (50%)

Return to query results.
Submit another query.