DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and srsf12

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001007946.1 Gene:srsf12 / 493321 XenbaseID:XB-GENE-994981 Length:253 Species:Xenopus tropicalis


Alignment Length:241 Identity:85/241 - (35%)
Similarity:116/241 - (48%) Gaps:66/241 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDA 77
            :|||     ..||.|.|:...|.||||||.|.|.|.:.|:|:|.|.|||..||||:::|.|.|||
 Frog     5 SRPP-----NTSLFVRNVADATRPEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYIQFEDVRDA 64

  Fly    78 EDALEAMDGRMLDGRELRVQMAR---------------------------YGRPSSPTRSSS--- 112
            ||||..::.:.:.||::.:|.|:                           :.|..:.:||||   
 Frog    65 EDALYNLNRKWVCGRQIEIQFAQGDRKTPGQMKSKERHACSPVDRRRSRSHSRRRTRSRSSSWDR 129

  Fly   113 GRRGGGGGGGSGGRR------RSRSRSPMRRRSRSPRRRSYSRSR------SPGSHSPERRSKFS 165
            |||..|....|..||      :|||:|| :||||:|:|.|:||.|      ||....|:..|..|
 Frog   130 GRRRSGSLKSSRHRRHSYSHSKSRSKSP-QRRSRTPQRHSFSRGRSRSMEKSPSGSPPKESSSGS 193

  Fly   166 RSPVRGDSRNGIGSGSGGLAP----------------AASRSRSRS 195
            :|  |...|....:.|...:|                ::|||||||
 Frog   194 KS--RSGQRRSGSTRSHSKSPRHRHSNSLSQKEAARHSSSRSRSRS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 37/75 (49%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 35/71 (49%)
srsf12NP_001007946.1 RRM <5..187 CDD:223796 70/187 (37%)
RRM_SRSF10_SRSF12 10..93 CDD:240758 38/82 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.