DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and srsf7

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001007487.1 Gene:srsf7 / 493215 XenbaseID:XB-GENE-920026 Length:234 Species:Xenopus tropicalis


Alignment Length:224 Identity:77/224 - (34%)
Similarity:94/224 - (41%) Gaps:52/224 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALE 82
            |..|...:.|.||.......:|.|.|...|.:..::|     .|...|||||.|.|.||||||:.
 Frog     6 RYAGEAKVYVGNLGTGAGKGELERAFSYYGPLRTVWI-----ARNPPGFAFVEFEDTRDAEDAVR 65

  Fly    83 AMDGRMLDGRELRVQM-------ARYGRP--------------------------------SSPT 108
            .:||:::.|..:||::       :||.||                                .|.|
 Frog    66 GLDGKVICGSRVRVELSTGMPRRSRYDRPPARRPFDPSDRCYECGEKGHYAYDCQRYSRRRRSRT 130

  Fly   109 RS-----SSGRRGGGGGGGSGGRRRSRSRSPMRRRSRSPRRRSYSRSRSPGSHSPERRSKFSRSP 168
            ||     |.|||.......|.| |||||.||.|.||.||||...:..||..|.|.:|....|||.
 Frog   131 RSRSHSRSRGRRYTRSRSRSRG-RRSRSASPRRSRSASPRRSRNATPRSSRSGSVKRSRSLSRSR 194

  Fly   169 VRGD--SRNGIGSGSGGLAPAASRSRSRS 195
            .|..  ||....|.|...:|..|||.|||
 Frog   195 SRSRSVSRPRSRSKSRSASPKRSRSPSRS 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 27/82 (33%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 26/71 (37%)
srsf7NP_001007487.1 RRM_SF 12..88 CDD:327398 27/80 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1533297at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.