DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and rbm34

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_001002382.1 Gene:rbm34 / 436655 ZFINID:ZDB-GENE-040718-77 Length:411 Species:Danio rerio


Alignment Length:134 Identity:36/134 - (26%)
Similarity:66/134 - (49%) Gaps:6/134 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRM 88
            |:.|.||.|..:...|:..|:.||.:..:.:.|||.:...:||.:|.|........||: ::|..
Zfish   253 SIFVGNLPYDISELPLQNHFQECGNIEAVRLVRDRDSGMGKGFGYVLFESPDSVMLALK-LNGST 316

  Fly    89 LDGRELRVQMA---RYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRRRSRSPRRRSYSRS 150
            |..|::||:.:   ...:.:.|.|.:.|:|  .|||..|.::..|:.:..:..:::||.:....|
Zfish   317 LQQRKIRVKRSVKKEKEKKTPPGRKAEGQR--TGGGLKGPKQEFRNNTGRKNFTKNPRNKPTQAS 379

  Fly   151 RSPG 154
            ...|
Zfish   380 SFKG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 21/71 (30%)
rbm34NP_001002382.1 RRM1_RBM34 149..240 CDD:409828
RRM2_RBM34 253..325 CDD:409829 22/72 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.