DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and Rox8

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_732944.2 Gene:Rox8 / 42848 FlyBaseID:FBgn0005649 Length:470 Species:Drosophila melanogaster


Alignment Length:140 Identity:45/140 - (32%)
Similarity:70/140 - (50%) Gaps:7/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 RPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAE 78
            :|...|.....:.|.:|:.....|.||..|...||:.:..|.||.:|.:|:|:|||.|..|.:||
  Fly    86 QPKTDISSHHHIFVGDLSPEIETETLREAFAPFGEISNCRIVRDPHTMKSKGYAFVSFVKKAEAE 150

  Fly    79 DALEAMDGRMLDGRELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRRRSRSPR 143
            :|::||:|:.:..|.:|...:....|.....|..|.:|||.|||.|      :.|.::...|...
  Fly   151 NAIQAMNGQWIGSRSIRTNWSTRKLPPPREPSKGGGQGGGMGGGPG------NGSGVKGSQRHTF 209

  Fly   144 RRSYSRSRSP 153
            ...|::| ||
  Fly   210 EEVYNQS-SP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 27/71 (38%)
Rox8NP_732944.2 RRM1_TIA1_like 9..80 CDD:409788
RRM2_TIA1_like 96..170 CDD:409789 27/73 (37%)
RRM_SF 221..292 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.