DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and CG5213

DIOPT Version :9

Sequence 1:NP_001188794.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:141 Identity:44/141 - (31%)
Similarity:62/141 - (43%) Gaps:11/141 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ARPPPRIDGMVSLKVDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDA 77
            |||........||.|.||......:.:|.:|...|.:.|:.:.|.::...|||.||::|...|||
  Fly   117 ARPSEYESTSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDA 181

  Fly    78 EDALEAMDGRMLDG--RELRVQMARYGRPSSPTRSSSGRRGGGGGGGSGGRRRSRSRSPMRRRSR 140
            |.|...||..|::|  |.|.|:.....:..|.:.||         |.....:|..|..|.:||.|
  Fly   182 EVAKYGMDRYMIEGASRPLTVKFVEREKKGSSSTSS---------GSQYKDKRKSSPPPYKRRER 237

  Fly   141 SPRRRSYSRSR 151
            :.......|||
  Fly   238 TNDHHVSKRSR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_001188794.1 RRM <24..>100 CDD:223796 28/77 (36%)
RRM_SRSF2_SRSF8 25..97 CDD:240757 26/73 (36%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 44/141 (31%)
RRM 128..202 CDD:214636 27/73 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23147
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.