DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SC35 and sqd

DIOPT Version :10

Sequence 1:NP_652612.1 Gene:SC35 / 53444 FlyBaseID:FBgn0265298 Length:195 Species:Drosophila melanogaster
Sequence 2:NP_731825.1 Gene:sqd / 41666 FlyBaseID:FBgn0263396 Length:344 Species:Drosophila melanogaster


Alignment Length:106 Identity:30/106 - (28%)
Similarity:52/106 - (49%) Gaps:10/106 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VDNLTYRTTPEDLRRVFERCGEVGDIYIPRDRYTRESRGFAFVRFYDKRDAEDALEAMDGRMLDG 91
            |..||...:.|:::..|.:.|.:.::.:|.|:...:.:||.|:.|..::...|.|:. ..:.:.|
  Fly   140 VGGLTTEISDEEIKTYFGQFGNIVEVEMPFDKQKSQRKGFCFITFDSEQVVTDLLKT-PKQKIAG 203

  Fly    92 RELRVQMARYGRPSSPTRSSSGRRGG------GGGGGSGGR 126
            :|:.|:.|   .|....:...|.|||      ||.||.|||
  Fly   204 KEVDVKRA---TPKPENQMMGGMRGGPRGGMRGGRGGYGGR 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SC35NP_652612.1 RRM_SRSF2_SRSF8 25..97 CDD:409751 16/69 (23%)
sqdNP_731825.1 RRM1_hnRNPA_hnRNPD_like 58..129 CDD:409763
RRM2_hnRNPD_like 137..211 CDD:240775 17/71 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.